SoyBase Follow us on Twitter @SoyBaseDatabase
Integrating Genetics and Genomics to Advance Soybean Research



Report for Sequence Feature Glyma13g18450

Feature Type:gene_model
Chromosome:Gm13
Start:22109247
stop:22113254
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT1G03880AT Annotation by Michelle Graham. TAIR10: cruciferin 2 | chr1:985786-987916 FORWARD LENGTH=455 SoyBaseE_val: 4.00E-82ISS
GO:0009640GO-bp Annotation by Michelle Graham. GO Biological Process: photomorphogenesis SoyBaseN/AISS
GO:0009686GO-bp Annotation by Michelle Graham. GO Biological Process: gibberellin biosynthetic process SoyBaseN/AISS
GO:0009737GO-bp Annotation by Michelle Graham. GO Biological Process: response to abscisic acid stimulus SoyBaseN/AISS
GO:0009793GO-bp Annotation by Michelle Graham. GO Biological Process: embryo development ending in seed dormancy SoyBaseN/AISS
GO:0009845GO-bp Annotation by Michelle Graham. GO Biological Process: seed germination SoyBaseN/AISS
GO:0009909GO-bp Annotation by Michelle Graham. GO Biological Process: regulation of flower development SoyBaseN/AISS
GO:0009933GO-bp Annotation by Michelle Graham. GO Biological Process: meristem structural organization SoyBaseN/AISS
GO:0010162GO-bp Annotation by Michelle Graham. GO Biological Process: seed dormancy process SoyBaseN/AISS
GO:0010182GO-bp Annotation by Michelle Graham. GO Biological Process: sugar mediated signaling pathway SoyBaseN/AISS
GO:0010228GO-bp Annotation by Michelle Graham. GO Biological Process: vegetative to reproductive phase transition of meristem SoyBaseN/AISS
GO:0010431GO-bp Annotation by Michelle Graham. GO Biological Process: seed maturation SoyBaseN/AISS
GO:0016567GO-bp Annotation by Michelle Graham. GO Biological Process: protein ubiquitination SoyBaseN/AISS
GO:0019915GO-bp Annotation by Michelle Graham. GO Biological Process: lipid storage SoyBaseN/AISS
GO:0050826GO-bp Annotation by Michelle Graham. GO Biological Process: response to freezing SoyBaseN/AISS
GO:0071215GO-bp Annotation by Michelle Graham. GO Biological Process: cellular response to abscisic acid stimulus SoyBaseN/AISS
GO:0045735GO-mf Annotation by Michelle Graham. GO Molecular Function: nutrient reservoir activity SoyBaseN/AISS
PF00190PFAM Cupin JGI ISS
UniRef100_Q39922UniRef Annotation by Michelle Graham. Best UniRef hit: Gy5 protein n=4 Tax=Glycine RepID=Q39922_GLYSO SoyBaseE_val: 0ISS
UniRef100_Q39922UniRef Annotation by Michelle Graham. Most informative UniRef hit: Gy5 protein n=4 Tax=Glycine RepID=Q39922_GLYSO SoyBaseE_val: 0ISS

LocusGene SymbolProtein Name
Gy5 Glycinin gene 5
glycinin A3B4 glycinin A3B4 subunit

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection
Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

ParalogEvidenceComments
Glyma10g04280 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Corresponding NameAnnotation VersionEvidenceComments
Glyma.13g123500 Wm82.a2.v1IGC As supplied by JGI

Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

>Glyma13g18450.2   sequence type=CDS   gene model=Glyma13g18450   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGGGAAGCCCTTCTTCACTCTCTCTCTTTCTTCCCTTTGCTTGCTACTCTTGTCGAGTGCATGCTTTGCTATTACCTCCAGCAAGTTCAACGAGTGCCAACTCAACAACCTCAACGCGTTGGAACCCGACCACCGCGTTGAGTCCGAAGGTGGTCTTATTGAAACATGGAACTCTCAACACCCTGAGCTGCAATGCGCCGGTGTCACTGTTTCCAAACGCACCCTCAACCGCAACGGCCTCCACTTGCCATCTTACTCACCTTATCCCCAAATGATCATTGTCGTTCAAGGGAAGGGAGCAATTGGATTTGCATTTCCGGGATGTCCTGAGACGTTTGAGAAGCCACAACAGCAATCAAGCAGAAGAGGCTCAAGGTCGCAGCAGCAACTACAAGACAGTCACCAGAAGATTCGTCACTTCAATGAAGGAGACGTACTAGTGATTCCTCCTGGTGTTCCTTACTGGACCTATAACACTGGCGATGAACCAGTTGTTGCCATCAGTCTTCTTGACACCTCCAACTTCAACAATCAGCTTGATCAAAACCCCAGAGTATTTTACCTTGCTGGGAACCCAGATATAGAGCACCCAGAGACCATGCAACAACAGCAGCAGCAGAAGAGTCATGGTGGACGCAAGCAGGGGCAACACCAGCAGCAGGAGGAAGAAGGTGGCAGTGTGCTCAGTGGCTTCAGCAAACATTTCTTAGCACAATCCTTCAACACCAACGAGGACACAGCTGAGAAACTTCGGTCTCCAGATGACGAAAGGAAGCAGATCGTGACAGTGGAGGGAGGCCTCAGCGTTATCAGCCCCAAGTGGCAAGAACAAGAAGACGAAGACGAAGATGAAGACGAAGAATATGAACAAACTCCCTCTTATCCTCCACGACGACCAAGCCATGGAAAGCATGAAGATGACGAGGACGAGGACGAAGAAGAAGATCAACCTCGTCCTGATCACCCTCCACAGCGACCAAGCAGGCCCGAACAACAAGAACCACGTGGAAGAGGATGTCAGACTAGAAATGGGGTTGAGGAAAATATTTGCACCATGAAGCTTCACGAGAACATTGCTCGCCCTTCACGTGCTGACTTCTACAACCCAAAAGCTGGTCGCATTAGCACCCTCAACAGTCTCACCCTCCCAGCCCTCCGCCAATTCGGACTCAGTGCCCAATATGTTGTCCTCTACAGGAATGGAATTTACTCTCCACATTGGAACTTGAACGCGAACAGTGTGATCTATGTGACTCGAGGGAAAGGAAGAGTTAGAGTGGTGAACTGCCAAGGGAATGCAGTGTTCGACGGTGAGCTAAGGAGGGGACAATTGCTAGTGGTGCCGCAGAACTTTGTGGTGGCTGAGCAAGGGGGAGAACAAGGATTGGAATACGTAGTGTTCAAGACACACCACAACGCCGTGAGCAGCTACATTAAGGATGTGTTTAGGGCAATCCCTTCGGAGAAAGTGTAA

>Glyma13g18450.2   sequence type=predicted peptide   gene model=Glyma13g18450   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MGKPFFTLSLSSLCLLLLSSACFAITSSKFNECQLNNLNALEPDHRVESEGGLIETWNSQHPELQCAGVTVSKRTLNRNGLHLPSYSPYPQMIIVVQGKGAIGFAFPGCPETFEKPQQQSSRRGSRSQQQLQDSHQKIRHFNEGDVLVIPPGVPYWTYNTGDEPVVAISLLDTSNFNNQLDQNPRVFYLAGNPDIEHPETMQQQQQQKSHGGRKQGQHQQQEEEGGSVLSGFSKHFLAQSFNTNEDTAEKLRSPDDERKQIVTVEGGLSVISPKWQEQEDEDEDEDEEYEQTPSYPPRRPSHGKHEDDEDEDEEEDQPRPDHPPQRPSRPEQQEPRGRGCQTRNGVEENICTMKLHENIARPSRADFYNPKAGRISTLNSLTLPALRQFGLSAQYVVLYRNGIYSPHWNLNANSVIYVTRGKGRVRVVNCQGNAVFDGELRRGQLLVVPQNFVVAEQGGEQGLEYVVFKTHHNAVSSYIKDVFRAIPSEKV*







Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo